PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_249.9
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family Whirly
Protein Properties Length: 240aa    MW: 26733.7 Da    PI: 10.3422
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_249.9genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly198.31e-61631991137
                       Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaa 82 
                                  s+yk+kaal++++v+ptf +ldsg l+++r+G ++l++ +a++erkydW+ +q+falsatev+++++l++ +++effhdp++
  evm.model.supercontig_249.9  63 SIYKGKAALSMEPVLPTFAKLDSGGLRVDRRGVMMLTFLPAIGERKYDWQSRQKFALSATEVGSFISLGPTGASEFFHDPSM 144
                                  7********************************************************************************* PP

                       Whirly  83 kgsneGkvrkalkvePlpdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsl 137
                                  k+sn+G+v+k+l+v+P++d sG+f++lsv+ns++k+ e+++vPv+ aef v++++
  evm.model.supercontig_249.9 145 KSSNAGQVKKTLSVKPHADASGYFISLSVNNSILKTTERITVPVTSAEFQVMKTA 199
                                  *****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.108.9E-7351220IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544471.73E-6456220IPR009044ssDNA-binding transcriptional regulator
PfamPF085361.3E-5764198IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005739Cellular Componentmitochondrion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MLKLSRCSFA RNLLSNKQFL EYGPDVRDAR YLCAFTSRAG VSTTRQNFTA KGNFAGRVFA  60
PYSIYKGKAA LSMEPVLPTF AKLDSGGLRV DRRGVMMLTF LPAIGERKYD WQSRQKFALS  120
ATEVGSFISL GPTGASEFFH DPSMKSSNAG QVKKTLSVKP HADASGYFIS LSVNNSILKT  180
TERITVPVTS AEFQVMKTAC SFALPHIMGW DWLNNQQHKH REINSMRLDS RALDLEWDK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4kop_A1e-89552168169Single-stranded DNA-binding protein WHY2, mit
4kop_B1e-89552168169Single-stranded DNA-binding protein WHY2, mit
4kop_C1e-89552168169Single-stranded DNA-binding protein WHY2, mit
4kop_D1e-89552168169Single-stranded DNA-binding protein WHY2, mit
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010534870.11e-103PREDICTED: single-stranded DNA-binding protein WHY2, mitochondrial
SwissprotQ8VYF79e-96WHY2_ARATH; Single-stranded DNA-binding protein WHY2, mitochondrial
TrEMBLA0A058ZZG41e-102A0A058ZZG4_EUCGR; Uncharacterized protein
STRINGAT1G71260.12e-93(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM123582731
Representative plantOGRP23161635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71260.15e-97WHIRLY 2